LL-37 (10mg) Vial

SKU: LL-37  | 5mg

LL-37  (10mg) Vial

Click Here – Complete Listing of Available Peptides / Pricing and Ordering Information!

  • LL-37 (5mg) is an antimicrobial peptide recognized for its potential to combat harmful bacteria, viruses, and fungi, making it a valuable tool in research on infection control and immune support.
  • This peptide plays a key role in modulating immune responses, helping to promote a balanced and efficient immune system while reducing excessive inflammation.
  • LL-37 has demonstrated wound-healing properties by supporting tissue repair and regeneration, as well as enhancing the body’s natural ability to fight infections in compromised areas.
  • In addition to its antimicrobial effects, LL-37 has shown promise in studies exploring its role in reducing biofilm formation, a common issue in chronic infections, and protecting against antibiotic-resistant strains.
  • Ideal for researchers investigating immune health, wound healing, and antimicrobial therapies, LL-37 (5mg) offers a cutting-edge solution for advancing scientific knowledge in these critical areas.

REQUEST MORE INFORMATION

80+ name brands
 to choose from

Serving over 7,500 Med Spas nationwide

Helping Med Spas Stock Smarter – One Click at a Time

What is LL-37 (5mg)?

LL-37 is a 37-amino acid peptide derived from cathelicidin, a naturally occurring protein in human immune cells. As part of the body’s innate defense mechanism, LL-37 plays a crucial role in combating bacterial, viral, and fungal pathogens. Research highlights its broad-spectrum antimicrobial activity, ability to modulate immune responses, and its role in promoting wound healing and tissue repair. LL-37’s antimicrobial properties extend to reducing biofilm formation, a major factor in chronic infections, making it an intriguing focus for ongoing studies into immune health and infection control.

Moreover, LL-37 has demonstrated the ability to influence cellular processes such as angiogenesis (the formation of new blood vessels), tissue regeneration, and inflammation modulation. These properties position LL-37 as a promising peptide for research into antimicrobial therapies, immune regulation, and regenerative medicine.

Derived from a naturally occurring protein in the immune system, synthetic LL-37 retains the vital functions of its natural counterpart, offering potential applications in infection management, chronic wound healing, and even inflammation-related disorders. Researchers continue to explore its potential in therapeutic applications, making LL-37 an exciting area of peptide science.

Chemical Structure of LL-37 (5mg)

LL-37 is a linear cationic amphipathic peptide composed of 37 amino acids. Its amino acid sequence is as follows:

[LL-37, 37 aa]

This structure allows LL-37 to interact with microbial membranes, disrupting their integrity and neutralizing pathogens. Its unique sequence also underpins its immunomodulatory and regenerative properties.

What Are the Effects of LL-37 (5mg)?

Broad-Spectrum Antimicrobial Activity

LL-37 exhibits potent antimicrobial properties, targeting bacteria, viruses, and fungi. Its mechanism involves binding to microbial membranes, destabilizing their structure, and neutralizing harmful pathogens. This makes LL-37 a subject of interest in research on antimicrobial resistance and chronic infections.

Reduces Biofilm Formation

Biofilms are structured communities of microorganisms that resist standard treatments. LL-37 has been shown to inhibit biofilm formation and disrupt existing biofilms, potentially improving outcomes in infections resistant to conventional antibiotics.

Supports Wound Healing and Tissue Repair

LL-37 promotes the regeneration of damaged tissues by enhancing angiogenesis and modulating inflammation. These effects make it a valuable peptide for research into chronic wound healing and regenerative medicine.

Modulates Immune Response

LL-37 helps regulate the immune system by balancing pro-inflammatory and anti-inflammatory responses. This modulation aids in reducing excessive inflammation while still supporting effective pathogen defense, offering potential insights into treatments for autoimmune and inflammatory disorders.

Anti-Inflammatory Effects

Studies have shown that LL-37 can suppress excessive inflammatory responses by interacting with immune signaling pathways. These properties make it a promising candidate for research into conditions involving chronic inflammation, such as arthritis or inflammatory bowel disease.

Potential Applications in Chronic Conditions

Emerging research suggests LL-37 may have therapeutic potential in addressing chronic infections, skin conditions like psoriasis, and even certain cancers. Its ability to influence both innate and adaptive immunity is driving interest in its broader applications.