BDNF (Brain-derived neurotrophic factor) (10mg) Vial

SKU: BDNF | 10mg

BDNF (Brain-derived neurotrophic factor) (10mg) Vial

Click Here – Complete Listing of Available Peptides / Pricing and Ordering Information!

  • BDNF (Brain-Derived Neurotrophic Factor) (10mg) is a neurotrophic peptide designed to support brain health by promoting the survival, growth, and maintenance of neurons in the central nervous system.
  • This peptide plays a critical role in neuroplasticity, facilitating the formation of new synapses and enhancing cognitive function, memory retention, and learning capabilities.
  • BDNF has been shown to protect against neurodegenerative conditions, making it an important factor in maintaining brain health and potentially reducing the risk of age-related cognitive decline.
  • Through its ability to stimulate neuronal growth and regeneration, BDNF is highly regarded for supporting mental clarity, mood stabilization, and overall brain performance.
  • Ideal for individuals looking to enhance cognitive function, improve brain health, and support long-term neuroprotection, BDNF is a powerful peptide for optimizing mental performance.

REQUEST MORE INFORMATION

80+ name brands
 to choose from

Serving over 7,500 Med Spas nationwide

Helping Med Spas Stock Smarter – One Click at a Time

What is BDNF (Brain-derived neurotrophic factor) (10mg)?

BDNF, a synthetic derivative of brain-derived neurotrophic factor, possesses multifunctional capabilities essential for brain health. This peptide promotes the growth, survival, and differentiation of neurons, making it a key player in neuroplasticity and cognitive enhancement. BDNF showcases its effectiveness in supporting learning and memory, improving mood, and providing neuroprotection.

Comprising a large and complex structure, BDNF’s ability to bind to its receptors, TrkB and p75NTR, enables it to exert its diverse biological effects. Over extended usage periods, BDNF has been shown to significantly improve cognitive function, enhance mood, and offer neuroprotective benefits. The diverse effects of BDNF include increased synaptic plasticity, improved neural health, and reduced risk of neurodegenerative diseases. Moreover, BDNF’s impact on mental health highlights its potential as a versatile agent in neurological and cognitive health management.

Chemical Structure of BDNF (Brain-derived neurotrophic factor) (10mg)

BDNF, a brain-derived neurotrophic factor, is a synthetic peptide with a specific amino acid sequence. The chemical structure and sequence of BDNF are as follows:

Mature peptide sequence:

QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRH

Structure: Contains specific disulfide bridges critical for its function.

What Are the Effects of BDNF (Brain-derived neurotrophic factor) (10mg)?

Enhanced Cognitive Function
BDNF, a critical neurotrophic factor, plays a significant role in enhancing cognitive function. By promoting the growth, development, and maintenance of neurons, BDNF supports neuroplasticity, which is essential for learning and memory. This peptide’s ability to enhance synaptic connections and improve brain function makes it a potent tool for cognitive health and neurological recovery.

Mood Regulation
One of the primary physiological functions of BDNF is its impact on mood regulation. BDNF enhances the survival and function of serotonergic neurons, contributing to improved mood and emotional well-being. Research indicates that higher levels of BDNF are associated with reduced symptoms of depression and anxiety, making it a valuable component in mental health management.

Neuroprotection
Beyond its cognitive and mood-enhancing effects, BDNF offers significant neuroprotective benefits. This peptide helps protect neurons from damage and supports recovery following neural injury. By promoting the survival and health of neurons, BDNF reduces the risk of neurodegenerative conditions and supports overall brain health.

Increased Synaptic Plasticity
BDNF plays a crucial role in increasing synaptic plasticity, which is the brain’s ability to adapt and reorganize itself. This enhancement in synaptic plasticity contributes to improved learning, memory formation, and overall cognitive performance. BDNF’s positive impact on synaptic plasticity highlights its importance in maintaining and improving brain function.